SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029368 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000029368
Domain Number - Region: 139-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0667
Family Calponin-homology domain, CH-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029368   Gene: ENSPTRG00000017167   Transcript: ENSPTRT00000031783
Sequence length 198
Comment pep:known chromosome:CHIMP2.1.4:5:119911654:119950365:1 gene:ENSPTRG00000017167 transcript:ENSPTRT00000031783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTRE
YTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVD
YTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKP
HLQKLCDGINKMLDEENI
Download sequence
Identical sequences A0A2I2ZF89 H2QRD4 O95379
9606.ENSP00000408534 NP_001273742.1.87134 NP_001273742.1.92137 NP_055165.2.87134 NP_055165.2.92137 XP_001152429.1.37143 XP_003826759.1.60992 XP_004042439.1.27298 gi|117676365|ref|NP_055165.2| ENSPTRP00000029368 ENSGGOP00000002931 GO.35268 ENSP00000421848 ENSP00000422245 ENSGGOP00000002931 ENSPTRP00000029368 ENSP00000421848 ENSP00000422245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]