SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029429 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029429
Domain Number 1 Region: 322-542
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-50
Family Reprolysin-like 0.0029
Further Details:      
 
Domain Number 2 Region: 1087-1143
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000196
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 980-1036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 915-976
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 635-685
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1038-1082
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000029429
Domain Number - Region: 143-153
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029429   Gene: ENSPTRG00000017203   Transcript: ENSPTRT00000031849
Sequence length 1207
Comment pep:known chromosome:CHIMP2.1.4:5:130103475:130386072:1 gene:ENSPTRG00000017203 transcript:ENSPTRT00000031849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDPAGGSGGSADP
GWVRGVGGGGSARAQAAGSSREVRSVAPVPLEEPVEGRSESRLRPPPPSEGEEDEELESQ
ELPRGSSGAAALSPGAPASWQPPPPPQPPPSPPPAQHAEPDGDEVLLRIPAFSRDLYLLL
RRDGRFLAPRFAVEQRPNPGPGPTGAASAPQPPAPPDAGCFYTGAVLRHPGSLASFSTCG
GGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDK
GRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGADAARRFILTILNMVFNL
FQHKSLGVQVNLRVIKLILLHETPPELYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMST
NWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTI
AHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNC
LLQTNPQSVNSVMVPSKLPGMTYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKE
CRTKLDPPMDGTDCDPGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKC
PGLGSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHVLQWQAVLDEE
KPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDICANGRCQKVGCDGLLGSLAREDHCG
VCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSYLALRDAGKQSIN
SDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGPTTAPLHLLVLLFQDQNYGLHYEYTIP
SDPLPENQSSKAPEPLFMWTHTSWEDCDATCGGGERKTTVSCTKIMSKNISIVDNEKCKY
LTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGKGMQSRQVACTQQLSNGTLIRARERDC
IGPKPASAQRCEGQDCMTVWEAGVWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPREAE
DCEDYSKCYVWRMGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHL
QPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYA
QKLQQKS
Download sequence
Identical sequences A0A2J8LS73
ENSPTRP00000029429 ENSPTRP00000029429 9598.ENSPTRP00000029429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]