SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029657 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029657
Domain Number 1 Region: 913-1088
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00052
Further Details:      
 
Domain Number 2 Region: 490-606
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 284-380
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-24
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1174-1321
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-18
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000412
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 6 Region: 605-783
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000285
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 391-498
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000204
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 798-906
Classification Level Classification E-value
Superfamily PH domain-like 0.00000011
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1131-1194
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000313
Family Ras-binding domain, RBD 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029657   Gene: ENSPTRG00000017351   Transcript: ENSPTRT00000032104
Sequence length 1544
Comment pep:known chromosome:CHIMP2.1.4:5:142402189:142440485:-1 gene:ENSPTRG00000017351 transcript:ENSPTRT00000032104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQDRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRHCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVAGPNLLKNMTQLLCVEAFEGEEPWFPPALDGSCPGL
LPSDPSPGVYNEVVVPATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILTGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSGPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
Download sequence
Identical sequences ENSPTRP00000029657 ENSPTRP00000029657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]