SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029679 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029679
Domain Number 1 Region: 531-777
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-63
Family Nuclear receptor ligand-binding domain 0.000000000281
Further Details:      
 
Domain Number 2 Region: 418-501
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-25
Family Nuclear receptor 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029679   Gene: ENSPTRG00000017363   Transcript: ENSPTRT00000032126
Sequence length 778
Comment pep:known chromosome:CHIMP2.1.4:5:144038019:144162888:-1 gene:ENSPTRG00000017363 transcript:ENSPTRT00000032126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESLTPGREENPSSVLAQERGNVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLSRSTSVPENPKSSASTAVSAAPTEKKFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVI
EPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYS
WMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVS
YEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences H2QRP6
XP_009448149.1.37143 XP_009448150.1.37143 XP_009448151.1.37143 XP_009448152.1.37143 XP_009448153.1.37143 9598.ENSPTRP00000029679 ENSPTRP00000029679 ENSPTRP00000029679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]