SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029749 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029749
Domain Number 1 Region: 551-689,736-846
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.69e-62
Family Protein kinases, catalytic subunit 0.0000000293
Further Details:      
 
Domain Number 2 Region: 202-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000171
Family I set domains 0.056
Further Details:      
 
Domain Number 3 Region: 408-497
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000023
Family I set domains 0.046
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000104
Family I set domains 0.038
Further Details:      
 
Domain Number 5 Region: 97-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000922
Family I set domains 0.051
Further Details:      
 
Domain Number 6 Region: 311-406
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000014
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029749   Gene: ENSPTRG00000017409   Transcript: ENSPTRT00000032203
Sequence length 846
Comment pep:known chromosome:CHIMP2.1.4:5:150912221:150943261:-1 gene:ENSPTRG00000017409 transcript:ENSPTRT00000032203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLAPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNCYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKEQARLPVKWMAPESIFDCVYTVQSDVWS
YGILLW
Download sequence
Identical sequences ENSPTRP00000029749 ENSPTRP00000029749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]