SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029757 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029757
Domain Number 1 Region: 9-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-79
Family Protein kinases, catalytic subunit 0.0000037
Further Details:      
 
Domain Number 2 Region: 350-480
Classification Level Classification E-value
Superfamily NTF2-like 4.39e-43
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029757   Gene: ENSPTRG00000017414   Transcript: ENSPTRT00000032212
Sequence length 487
Comment pep:known chromosome:CHIMP2.1.4:5:151081647:151151776:-1 gene:ENSPTRG00000017414 transcript:ENSPTRT00000032212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARGRCLISVC
PTVTNCLAPPTVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILE
AVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLS
PEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVT
PEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKG
AILTTMLATRNFSGRWQDSHLFSLFFQKRKSSSSVQLMESSESTNTTIEDEDTKVRKQEI
IKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
HTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRS
GAPSVLP
Download sequence
Identical sequences ENSPTRP00000029757 ENSPTRP00000029757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]