SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030075 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030075
Domain Number 1 Region: 148-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.4e-76
Family Protein kinases, catalytic subunit 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030075   Gene: ENSPTRG00000017605   Transcript: ENSPTRT00000032549
Sequence length 481
Comment pep:known chromosome:CHIMP2.1.4:5:179721792:179748062:-1 gene:ENSPTRG00000017605 transcript:ENSPTRT00000032549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKK
K
Download sequence
Identical sequences H2QS47 Q9HAZ1
NP_065717.1.87134 NP_065717.1.92137 XP_001148601.2.37143 XP_003805423.1.60992 XP_016809885.1.37143 ENSPTRP00000030075 ENSP00000316948 9598.ENSPTRP00000030075 9606.ENSP00000316948 ENSPTRP00000030075 ENSP00000316948 ENSP00000316948 gi|10190706|ref|NP_065717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]