SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030092 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030092
Domain Number 1 Region: 264-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.52e-48
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 558-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 850-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000109
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 4 Region: 937-978
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000732
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000030092
Domain Number - Region: 913-936
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0017
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030092   Gene: ENSPTRG00000017614   Transcript: ENSPTRT00000032567
Sequence length 1161
Comment pep:known chromosome:CHIMP2.1.4:5:180242758:180483206:-1 gene:ENSPTRG00000017614 transcript:ENSPTRT00000032567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPAGAARRLLCPALLLLLLLPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAVPV
RTDAQGRLVSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEDPGSHLFYNVTVFGRDLHL
RLRPNARLVAPGATMEWQGEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAGLI
RMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLGSLDSLSHA
LGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIY
HDESLGAHINVVLVRIILLSHGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDH
AIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQG
NRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLP
GLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPG
KHCFKGHCIWLTPDILKRDGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSG
LAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCESR
ETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSHC
KVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLETGKFILNEENDVD
ASSKTFIAMGVEWEYRDGDGRETLQTMGPLHGTITVLVIPVGDSRVSLTYKYMIHEDSLN
VDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSKPK
AIRRACNPQECSQPVWVTGEWEPCSQTCGRTGMQVRCSVTCGNGTQERPVLCRTADDSFG
ICQEERPETARTCRLGPCPRNTSDPSKKSYVVQWLSRPDPDSPIQKISSKGHCQGDKSIF
CRMEVLSRYCSIPGYNKLCCKSCNLHNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTLAM
EVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQSPNLIPRRPSPYEKT
RNQRIQELIDEMRKKEMLGKF
Download sequence
Identical sequences ENSPTRP00000030092 ENSPTRP00000030092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]