SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030511 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030511
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.29e-18
Family Ubiquitin-related 0.0026
Further Details:      
 
Domain Number 2 Region: 97-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.52e-17
Family Ubiquitin-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030511   Gene: ENSPTRG00000017901   Transcript: ENSPTRT00000033028
Sequence length 165
Comment pep:known chromosome:CHIMP2.1.4:6:29807573:29811906:-1 gene:ENSPTRG00000017901 transcript:ENSPTRT00000033028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPNASCLCVHVRSEEWDLMTFDANPDDSVKKIKEHVRSKTKVPVQDQVLSLGSKILKPR
RSLSSYGIDKEKTIHLTLKVVKPGDEELPLFLVESVDEGKRHLLQVRRSSSVAQVKAMIE
TKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYYIGG
Download sequence
Identical sequences H2QSL3
ENSPTRP00000030511 ENSPTRP00000030511 XP_527322.2.37143 9598.ENSPTRP00000030511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]