SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030713 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030713
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 2.67e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000573
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 331-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000172
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000030713
Domain Number - Region: 166-175
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0141
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030713   Gene: ENSPTRG00000017993   Transcript: ENSPTRT00000033242
Sequence length 459
Comment pep:known chromosome:CHIMP2.1.4:6:32180403:32182774:-1 gene:ENSPTRG00000017993 transcript:ENSPTRT00000033242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGVSEASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
KLEFPLDEDLELKAEEEDEDEDEDVSDICIVKVESALEVAHRLKPPGGLGGGLGIGSSVG
GHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLVEAAAV
AMAARGAGGSLGAGGSRGPLPGGFSGGNPLKNIKCTKCPEVFQGVEKLVFHMRAQHFIFM
CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR
Download sequence
Identical sequences H2QSP8
XP_527347.2.37143 9598.ENSPTRP00000030713 ENSPTRP00000030713 ENSPTRP00000030713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]