SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030748 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030748
Domain Number 1 Region: 144-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000464
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 2 Region: 109-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000030748
Domain Number - Region: 197-227
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0248
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030748   Gene: ENSPTRG00000040302   Transcript: ENSPTRT00000033282
Sequence length 292
Comment pep:known chromosome:CHIMP2.1.4:6:32432297:32435967:1 gene:ENSPTRG00000040302 transcript:ENSPTRT00000033282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRAELCTLLGGFSFLLLLISGEGAKGGSLRESQGVCSKQTLVVPLRYNESYSQPVYKP
YLTLCAGRRICSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLN
GGVCVRPDQCECAPGWGGKHCHVDVDECRTSITLCSHRCFNTAGSFTCGCPHDLVLSVDG
RTCTEGSPEPPTSASILSVAVREAEKDERALKQEIHELRGRLERLEQWAGQAGAWVRAVL
PVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGLGVNR
Download sequence
Identical sequences H2QSQ8
XP_009449232.1.37143 XP_009449233.1.37143 ENSPTRP00000030748 ENSPTRP00000030748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]