SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030854 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030854
Domain Number 1 Region: 17-225
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-53
Family FCH domain 0.04
Further Details:      
 
Domain Number 2 Region: 298-359
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-19
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030854   Gene: ENSPTRG00000018064   Transcript: ENSPTRT00000033392
Sequence length 360
Comment pep:novel chromosome:CHIMP2.1.4:6:34954944:34961842:1 gene:ENSPTRG00000018064 transcript:ENSPTRT00000033392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQL
TDWAKRWRQLIEKLEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCK
QDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLTLA
NSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQP
KKAEGVALTNATGAVESSQAGDVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDD
SKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI
Download sequence
Identical sequences ENSPTRP00000030854 9598.ENSPTRP00000030854 ENSPTRP00000030854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]