SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030916 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030916
Domain Number 1 Region: 19-314
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-94
Family Protein kinases, catalytic subunit 0.00000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030916   Gene: ENSPTRG00000018098   Transcript: ENSPTRT00000033459
Sequence length 365
Comment pep:known chromosome:CHIMP2.1.4:6:36586827:36596365:1 gene:ENSPTRG00000018098 transcript:ENSPTRT00000033459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLXNFHDXYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
Download sequence
Identical sequences ENSPTRP00000030916 ENSPTRP00000030916 9598.ENSPTRP00000030916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]