SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031878 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031878
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.31e-79
Family Calponin-homology domain, CH-domain 0.000000416
Further Details:      
 
Domain Number 2 Region: 2842-2966
Classification Level Classification E-value
Superfamily EF-hand 1.84e-49
Family EF-hand modules in multidomain proteins 0.00000581
Further Details:      
 
Domain Number 3 Region: 2968-3063
Classification Level Classification E-value
Superfamily EF-hand 2.47e-38
Family EF-hand modules in multidomain proteins 0.0000149
Further Details:      
 
Domain Number 4 Region: 1923-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 3043-3131
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2505-2636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 389-526
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000158
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 2281-2439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000373
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000108
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 12 Region: 2682-2801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000128
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 13 Region: 963-1083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000013
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 14 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000168
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 15 Region: 1492-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000278
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 16 Region: 2055-2178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000406
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 17 Region: 2804-2841
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 1620-1745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000192
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 19 Region: 1083-1192
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000989
Family Spectrin repeat 0.007
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031878
Domain Number - Region: 1305-1396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0011
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 1414-1509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00199
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 690-759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.018
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number - Region: 2233-2298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031878   Gene: ENSPTRG00000018680   Transcript: ENSPTRT00000034488
Sequence length 3433
Comment pep:known chromosome:CHIMP2.1.4:6:145771210:146342620:1 gene:ENSPTRG00000018680 transcript:ENSPTRT00000034488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEASPDNGQNEFSEIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEEAINIQSTAPEEEHESPRAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELLNWILKSKTAIQTTEIKEYMK
MQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEW
KNVSQHLEDIERKIQLQEDINAYFKQLDELEKVLKTKEEWVKHTSISESSRQSLPSLKDS
CQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGCYQAVQEAVEDRQQHL
ENELKGQPGHAYLETLKTLKDVLDDSENKAQASLNVLNDLAKVEKALQEKKTLDEILENQ
KPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALKLRA
FEADSTVIEKWMDGVKDFLVKQQAAQGDDAGLQRQLDQCSAFVNEIETIESSLKNMKEIE
TNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEITTQKSRLSESQEKAANLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYED
LSHLAESKQISLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKI
QAEISAHELTLEELRRNMRSQPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMKKEAASLSEWL
SATETELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKADLNTITESSAALQNLIEGSEP
ILEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK
KPTSKQEEIVKRLVSELDDANLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKV
SQHIKSAKLLIAQEPLYQCLVTTETFETGVPFSDLEKLENDIENMLKFVEKHLESSDEDE
KMDEESAQIEEVLQRGEEMLHQPMEDNKKEKIRLQLLLLHTRYNKIKAIPIQQRKMGQLA
SGIRSSLLPTDYLVEINKILLCMDDVELSLNVPELNTAIYEDFSFQEDSLKNIKDQLDKL
GEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYSDRKGCFDRAMEEWRQ
FHCDLNDLTQWITEAEELLVDTCAPGGSLDLEKARIHQQELEVGISSHQPSFAALNRTGD
GIVQKLSQADGSFLKDKLAGLNQRWDAIVAEVKDRQPRLKGESKQVMEYRHQLDEIICWL
TKAEHAMQKRSTTEFGENLQELRDLTQEMEVHAEKLKWLNRTELEMLSDKSLSLPERDKI
SESLRTVNMTWNKICREVPTTLKECIQEPSSVSQTRIAAHPSVQKVVLVSSASDIPVQSH
RTSEISIPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRH
PQLDYVFTLAQNLKNKASSSDVRTAITEKLERVKNQWDGTQHGVELRQQQLEDMIIDSLQ
WDDHREETEELMRKYEARLYILQQARRDPLTKQISDNQILLQELGPGDGIVMAFDNVLQK
LLEEYGSDDTRNVKETTEYLKTSWINLKQSIADRQNALEAEWRTVQASRRDLENFLKWIQ
EAETTVNVLADASNRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKDE
ELKKQMPIGGDVPALQLQYDHCKALRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRR
NLQSKTELTPEERAQKIAKAMRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAM
DDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINFKVKTVNDLSSQLS
PLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQR
SISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDL
LELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQ
IPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAA
AETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPT
TSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDPS
QSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGES
PVSQPQSPAQILKSVEKEERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGLPVGSPPE
SIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDS
RINGVSPWASPQHSALSYSLDPDASGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHNTFP
SCCPNVPSRPQAM
Download sequence
Identical sequences H2QTV5
ENSPTRP00000031878 9598.ENSPTRP00000031878 ENSPTRP00000031878 XP_001172875.1.37143 XP_009450443.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]