SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031932 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031932
Domain Number 1 Region: 235-261,302-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-71
Family Nuclear receptor ligand-binding domain 0.000000000934
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031932   Gene: ENSPTRG00000018716   Transcript: ENSPTRT00000034547
Sequence length 595
Comment pep:known chromosome:CHIMP2.1.4:6:153370971:153789453:1 gene:ENSPTRG00000018716 transcript:ENSPTRT00000034547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKH
SKKNSPALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGAPVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Download sequence
Identical sequences B6CK16 H2QTX3
ENSPTRP00000031932 ENSPTRP00000031932 XP_003311596.1.37143 XP_003311597.1.37143 9598.ENSPTRP00000031932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]