SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032127 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032127
Domain Number 1 Region: 121-229
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-30
Family Second domain of FERM 0.0021
Further Details:      
 
Domain Number 2 Region: 27-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-16
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 230-360
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000984
Family Third domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032127   Gene: ENSPTRG00000018813   Transcript: ENSPTRT00000034755
Sequence length 522
Comment pep:known chromosome:CHIMP2.1.4:6:169876528:169901131:-1 gene:ENSPTRG00000018813 transcript:ENSPTRT00000034755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPSSERPACSQQEPTLGMDAMASEHRDVLVLLPSREQLRLAVGVKATGRELFQQVCNVA
SIRDAQFFGLCVVRNNEYIFMDLEQKLSKYFSKDWKKERNEGNEKPRAPFVAFLRVQHYV
ENGRVISDHRARHLYYCHLKERVLRSQCAHREEAYFLLAACALQADLGEHRESAHAGRYF
EPHSYFPQWIITKRGIDYILRHVPTLHGERQGLSPKEAMLCFIQEACRLEEVPVHFFRLH
KDKKEGRPTMILGLALRGVHIYQGKKLEIQLDGLPAAQKLVYYTGCTWRSRHLLQLLRAS
HQLHLRVRPTLQQLRQREEAEEKQHYRESYISDGLELDLASRSFPGSGVSSQHCPRCLSR
HSADSHGSSYTSGIKANSWLRESREMSVDVPLEVHGLHEKEPSSSPRTSCSHPSTRGDSQ
ATHQEPCTEVRTRGQSAEAVHQIQEMKAGVSEEQHSHGLDDMQLHQLALHPAPASLSHTF
HRALDCRLAGPCETRATLPSKRSSNCLALDLFGEAPPQEFVV
Download sequence
Identical sequences ENSPTRP00000032127 ENSPTRP00000032127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]