SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032199 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032199
Domain Number 1 Region: 83-178
Classification Level Classification E-value
Superfamily PX domain 1.2e-23
Family PX domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000032199
Domain Number - Region: 256-428
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family BAR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032199   Gene: ENSPTRG00000018859   Transcript: ENSPTRT00000034835
Sequence length 465
Comment pep:known chromosome:CHIMP2.1.4:7:961719:1017408:-1 gene:ENSPTRG00000018859 transcript:ENSPTRT00000034835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRAMDPLPAAAVGAAAEAEADEEADPPAADLPTPQAIEPQAIVQQAPAPSRMQMPQGN
PLLLSHTLQELLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEML
LHKFPYRMVPALPPKRMLGADREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGS
DVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISRELIRNIYNSFHKLRDRAE
RIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLAD
KAAQQGKQEENDVVEKLSLFLDLLQSYKDLCERHEKGVLHKHQRALHKYSLMKRQMMSAT
AQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH
Download sequence
Identical sequences A0A2I3TXH0
9598.ENSPTRP00000032199 ENSPTRP00000032199 XP_001136580.1.37143 ENSPTRP00000032199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]