SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000032616 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000032616
Domain Number 1 Region: 45-138
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.76e-27
Family Frizzled cysteine-rich domain 0.00000532
Further Details:      
 
Domain Number 2 Region: 172-280
Classification Level Classification E-value
Superfamily TIMP-like 1.23e-17
Family Netrin-like domain (NTR/C345C module) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000032616   Gene: ENSPTRG00000019092   Transcript: ENSPTRT00000035280
Sequence length 343
Comment pep:novel chromosome:CHIMP2.1.4:7:36474374:36484184:-1 gene:ENSPTRG00000019092 transcript:ENSPTRT00000035280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGREGRFLSAGVAAREGSAMFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWN
ITRMPNHLHHSTQENAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESL
ACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKV
KPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSC
QCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKK
TAGRTSRSNPPKPKGKPPAPKPTSPKKNIKTRSAQKRTNPKRE
Download sequence
Identical sequences ENSPTRP00000032616 ENSPTRP00000032616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]