SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033192 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033192
Domain Number 1 Region: 9-303
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.67e-92
Family Protein kinases, catalytic subunit 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033192   Gene: ENSPTRG00000019400   Transcript: ENSPTRT00000035908
Sequence length 326
Comment pep:known chromosome:CHIMP2.1.4:7:93141624:93361040:-1 gene:ENSPTRG00000019400 transcript:ENSPTRT00000035908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
Download sequence
Identical sequences A0A096NF27 A0A0D9RJK6 A0A2K5K1L5 A0A2K5MIA8 A0A2K5ZCQ4 A0A2K6DGQ0 A0A2K6N2K9 A0A2K6P4F4 F7E5V8 G7P1D7 H2PMX6 H2QUX4 Q00534
1blxA ENSP00000265734 gi|223718134|ref|NP_001138778.1| gi|4502741|ref|NP_001250.1| ENSP00000265734 ENSP00000397087 9544.ENSMMUP00000011403 9598.ENSPTRP00000033192 9600.ENSPPYP00000019970 9606.ENSP00000265734 ENSPPYP00000019970 ENSPTRP00000033192 ENSMMUP00000011403 ENSMMUP00000011403 NP_001138778.1.87134 NP_001138778.1.92137 NP_001248236.1.72884 NP_001250.1.87134 NP_001250.1.92137 XP_001167181.1.37143 XP_002818259.1.23681 XP_003318627.1.37143 XP_003809779.1.60992 XP_003809780.1.60992 XP_006715898.1.92137 XP_007980348.1.81039 XP_007980349.1.81039 XP_007980350.1.81039 XP_008960247.1.60992 XP_008960248.1.60992 XP_009241292.1.23681 XP_009241293.1.23681 XP_009241294.1.23681 XP_010387789.1.97406 XP_010387795.1.97406 XP_011729122.1.29376 XP_011729123.1.29376 XP_011729124.1.29376 XP_011729125.1.29376 XP_011729126.1.29376 XP_011810444.1.43180 XP_011810445.1.43180 XP_011810446.1.43180 XP_011853662.1.47321 XP_011853663.1.47321 XP_011853664.1.47321 XP_011887449.1.92194 XP_011887450.1.92194 XP_011887451.1.92194 XP_011887453.1.92194 XP_014989716.1.72884 XP_014989717.1.72884 XP_015303231.1.63531 XP_015303232.1.63531 XP_015303233.1.63531 XP_015303234.1.63531 XP_016813256.1.37143 XP_017725792.1.44346 XP_017725793.1.44346 ENSPANP00000011515 ENSPTRP00000033192 ENSP00000265734 ENSP00000397087 1bi7_A 1bi8_A 1bi8_C 1blx_A 1g3n_A 1g3n_E 4tth_B ENSPPYP00000019970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]