SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033867 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033867
Domain Number 1 Region: 307-322,362-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000465
Family Protein kinases, catalytic subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033867   Gene: ENSPTRG00000019770   Transcript: ENSPTRT00000036627
Sequence length 626
Comment pep:known chromosome:CHIMP2.1.4:7:142146258:142168183:1 gene:ENSPTRG00000019770 transcript:ENSPTRT00000036627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRNARLCWLLLGTLPKVVSLCGDVGEG
APDVLGRRRVRCSGAAGAGPAESLPRAGPLGGVFLHLRLWLRAGALLVKFFPLLLLYPLT
YLAPSVSTLWLHLLLKATETSGPTYIKLGQWASTRRDLFSEAFCAQFSKLHVRVTPHPWT
HTERFLRQAFGDDWGSILSFENREPVGSGCVAQVYKAYANTAFLETDSVQRLGRASCLPP
FSHTGAVGGLRELFGYLGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSWAQVPGHQP
EATNLIPVAVKVLHPGLLAQVHMDLLLMKIGSRVLGLLPGIKWLSLPEIVEEFEKLMVQQ
IDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPMDL
KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGADGLSSSQEAQLQQADICDTLVVAV
PSSLCPLRLVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVE
GFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGL
GRSLDPKLDILEAARPFLLTGPVCPL
Download sequence
Identical sequences H2QVI1
ENSPTRP00000033867 XP_001154570.2.37143 XP_016800952.1.37143 ENSPTRP00000033867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]