SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034342 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034342
Domain Number 1 Region: 125-319
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.54e-58
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 746-856
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 3 Region: 442-544
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 591-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 326-435
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-36
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 6 Region: 882-975
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 549-587,702-748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034342   Gene: ENSPTRG00000020054   Transcript: ENSPTRT00000037161
Sequence length 986
Comment pep:known chromosome:CHIMP2.1.4:8:18361640:18409452:1 gene:ENSPTRG00000020054 transcript:ENSPTRT00000037161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDE
EDLRAFQVQQAADLRQHTARKSSIKAAVAGNTSTPSCQSTNGQPQRGACGRWRGRSRSRR
AATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTY
RPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVREN
IQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIG
QRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKI
ILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSF
EIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGF
AVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNG
SITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK
LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVN
TFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST
PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLR
FYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY
GVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHS
DDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences H2QVU7
9598.ENSPTRP00000034342 XP_003823651.1.60992 XP_016814692.1.37143 ENSPTRP00000034342 ENSPTRP00000034342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]