SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034767 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034767
Domain Number 1 Region: 152-466
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-93
Family Protein kinases, catalytic subunit 0.00000006
Further Details:      
 
Domain Number 2 Region: 14-122
Classification Level Classification E-value
Superfamily PX domain 1.09e-30
Family PX domain 0.000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034767   Gene: ENSPTRG00000020312   Transcript: ENSPTRT00000037617
Sequence length 496
Comment pep:known chromosome:CHIMP2.1.4:8:64618647:64706235:1 gene:ENSPTRG00000020312 transcript:ENSPTRT00000037617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNT
LKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD
SPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAK
RKLDGKCYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVL
DFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHV
VLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPP
FYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFE
SLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD
AFVGFSYAPPSEDLFL
Download sequence
Identical sequences H2QW93
ENSPTRP00000034767 9598.ENSPTRP00000034767 ENSPTRP00000034767 XP_001161550.1.37143 XP_001161599.1.37143 XP_009453741.1.37143 XP_016815718.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]