SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034905 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034905
Domain Number 1 Region: 11-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-62
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 436-519
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-17
Family Caspase recruitment domain, CARD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034905   Gene: ENSPTRG00000020405   Transcript: ENSPTRT00000037765
Sequence length 539
Comment pep:known chromosome:CHIMP2.1.4:8:87948698:87982028:1 gene:ENSPTRG00000020405 transcript:ENSPTRT00000037765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAQDNDFSSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINP
LSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKP
TRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSSSLHLLQNKSM
Download sequence
Identical sequences H2QWE5
9598.ENSPTRP00000034905 ENSPTRP00000034905 ENSPTRP00000034905 XP_519850.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]