SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034950 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000034950
Domain Number - Region: 145-205
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.051
Family Allantoicase repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034950   Gene: ENSPTRG00000020437   Transcript: ENSPTRT00000037815
Sequence length 207
Comment pep:known chromosome:CHIMP2.1.4:8:93440497:93464787:-1 gene:ENSPTRG00000020437 transcript:ENSPTRT00000037815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKE
DDLDSLINEIFEEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGT
NISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYA
CQCSWRTIEEVTDLQTDHQLRWVCGKH
Download sequence
Identical sequences H2QWG3
XP_003821725.1.60992 ENSPTRP00000034950 ENSPTRP00000034950 9598.ENSPTRP00000034950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]