SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035228 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035228
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 2 Region: 115-185
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.05
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000102
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035228   Gene: ENSPTRG00000020602   Transcript: ENSPTRT00000038102
Sequence length 367
Comment pep:known chromosome:CHIMP2.1.4:8:131887524:131926256:1 gene:ENSPTRG00000020602 transcript:ENSPTRT00000038102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWFLPWTLAAVTAAAASTVLAMALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCVSTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
Download sequence
Identical sequences H2QWR3
XP_528234.2.37143 9598.ENSPTRP00000035228 ENSPTRP00000035228 ENSPTRP00000035228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]