SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035264 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035264
Domain Number 1 Region: 409-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 908-1046
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-59
Family FAT domain of focal adhesion kinase 0.000000167
Further Details:      
 
Domain Number 3 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.27e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 4 Region: 31-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-39
Family First domain of FERM 0.00000275
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-37
Family Third domain of FERM 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035264   Gene: ENSPTRG00000020624   Transcript: ENSPTRT00000038141
Sequence length 1052
Comment pep:known chromosome:CHIMP2.1.4:8:139425067:139769753:-1 gene:ENSPTRG00000020624 transcript:ENSPTRT00000038141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAFSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Download sequence
Identical sequences H2QWS1
XP_001147549.1.37143 XP_009454274.1.37143 ENSPTRP00000035264 ENSPTRP00000035264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]