SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035283 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035283
Domain Number 1 Region: 404-460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 465-515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000602
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 3 Region: 352-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 261-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000035283
Domain Number - Region: 1155-1164
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0018
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 784-985
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00723
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035283   Gene: ENSPTRG00000020635   Transcript: ENSPTRT00000038166
Sequence length 1327
Comment pep:novel chromosome:CHIMP2.1.4:8:141258241:141343663:1 gene:ENSPTRG00000020635 transcript:ENSPTRT00000038166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQAAAPGPVWILAPLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAVF
PANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESFD
EVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRNP
SRAPCQMLCRWLDACLAGSRSSHPCGIMQTPCAFLGGEAGGPAAGPLPPRGDVCLRDAVA
GGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCEG
VLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEWS
PWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLC
SSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACSA
SCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPELILRRCELDEEGIAYWEPPT
YIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEVIQTLVEISQDGTSYSGDLLSTIDVL
RNMTEIFRRAYYSPTPGDVQNFVQILSNLLAEENRDKWEEAQLAGPNAKELFRLVEDFVD
VIGFRMKDLRDAYQVTDNLVLSIHKLPASGATDISFPMKGWRATGDWAKVPEDRVTVSKS
VFSTGLAEADEASVFVVGTVLYRNLGSFLALQRNTTVLNSKVISVTVKPPPRSLRTPLEI
EFAHMYNGTTNQTCILWDETDFAQLSADANMEKATLPSVTLIVGCGVSSLTLLMLVIIYV
SVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHFFFLSSFCWVL
TEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTW
MSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRRETDFEKDVDLACRSSELSRAQ
EKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHLSTAPEASLPARSPPSRQ
PPSSGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLGDPGEPAAHPGPSTGPST
KNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAAEKDKEVLGPD
SKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRSVEWERSGATIPLVGQDI
IDLQTEV
Download sequence
Identical sequences ENSPTRP00000035283 ENSPTRP00000035283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]