SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035289 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035289
Domain Number 1 Region: 20-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000000288
Family Extracellular domain of cell surface receptors 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035289   Gene: ENSPTRG00000020639   Transcript: ENSPTRT00000038172
Sequence length 103
Comment pep:known chromosome:CHIMP2.1.4:8:141544971:141546437:-1 gene:ENSPTRG00000020639 transcript:ENSPTRT00000038172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAE
YPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Download sequence
Identical sequences A0A2I3SNA8 P55000
ENSPTRP00000035289 gi|9966907|ref|NP_065160.1| NP_065160.1.87134 NP_065160.1.92137 XP_001149955.1.37143 XP_003819529.1.60992 ENSP00000246515 ENSP00000246515 GO.56287 9598.ENSPTRP00000035289 9606.ENSP00000246515 ENSPTRP00000035289 ENSP00000246515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]