SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035291 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035291
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000397
Family Snake venom toxins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035291   Gene: ENSPTRG00000020640   Transcript: ENSPTRT00000038174
Sequence length 116
Comment pep:known chromosome:CHIMP2.1.4:8:141580094:141583159:-1 gene:ENSPTRG00000020640 transcript:ENSPTRT00000038174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKV
SKSCVPRCFETVYDGYSKHASTTSCCQYDLCNGAGLATPATLALAPILLATLWGLL
Download sequence
Identical sequences A0A2I2Z8F6 Q5IS42
NP_001012437.1.37143 XP_008971089.1.60992 XP_008971090.1.60992 XP_008971091.1.60992 XP_009454346.1.37143 XP_009454347.1.37143 XP_009454348.1.37143 XP_018887841.1.27298 ENSPTRP00000035291 ENSPTRP00000035291 ENSGGOP00000014358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]