SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035297 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035297
Domain Number 1 Region: 22-112
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000162
Family Snake venom toxins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035297   Gene: ENSPTRG00000020642   Transcript: ENSPTRT00000038180
Sequence length 158
Comment pep:known chromosome:CHIMP2.1.4:8:141638134:141650226:1 gene:ENSPTRG00000020642 transcript:ENSPTRT00000038180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFALLLAMELPLVAANATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI
RINSRELLVYKNCTNNCTFVYAAEQPPEAPRKIFKTNSFYWVRCCNSMVCNAGGPTNLER
DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Download sequence
Identical sequences H2QWT2
ENSPTRP00000035297 9598.ENSPTRP00000035297 ENSPTRP00000035297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]