SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035305 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035305
Domain Number 1 Region: 44-133
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000011
Family Snake venom toxins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035305   Gene: ENSPTRG00000020648   Transcript: ENSPTRT00000038188
Sequence length 161
Comment pep:known chromosome:CHIMP2.1.4:8:142055417:142058139:-1 gene:ENSPTRG00000020648 transcript:ENSPTRT00000038188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPQRTRAPSPRAAPRPTRSMLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSH
CTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILK
VDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Download sequence
Identical sequences A0A2J8R6X0 G3QHR2 H2QWT7
ENSP00000342711 ENSP00000399485 ENSP00000342711 NP_001123950.1.87134 NP_001123950.1.92137 NP_001129127.1.87134 NP_001129127.1.92137 XP_001151757.2.37143 XP_001151818.2.37143 9606.ENSP00000342711 ENSPTRP00000035305 ENSP00000342711 ENSP00000399485 ENSPTRP00000035305 gi|194440697|ref|NP_001123950.1| gi|208431840|ref|NP_001129127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]