SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035632 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035632
Domain Number 1 Region: 819-1106
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-70
Family Protein kinases, catalytic subunit 0.000000000088
Further Details:      
 
Domain Number 2 Region: 449-636
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-16
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 3 Region: 638-733
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-16
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 370-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000077
Family I set domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000035632
Domain Number - Region: 220-337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000439
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 132-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0137
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035632   Gene: ENSPTRG00000020835   Transcript: ENSPTRT00000038547
Sequence length 1123
Comment pep:known chromosome:CHIMP2.1.4:9:27494483:27619724:1 gene:ENSPTRG00000020835 transcript:ENSPTRT00000038547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLSH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKAYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VVNFLLSGTVCLPGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYE
RPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences ENSPTRP00000035632 ENSPTRP00000035632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]