SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035654 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035654
Domain Number 1 Region: 162-322
Classification Level Classification E-value
Superfamily HIT-like 6.03e-53
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.017
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.22e-35
Family FHA domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035654   Gene: ENSPTRG00000020850   Transcript: ENSPTRT00000038570
Sequence length 342
Comment pep:known chromosome:CHIMP2.1.4:9:33361334:33391235:-1 gene:ENSPTRG00000020850 transcript:ENSPTRT00000038570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAECNKGYVKVKQ
VGVNPTSIDSVVIGKDQEVKLQPGQVLHMVNELYPYIVEFEEEAKNPGLETHRKRKRSGN
SDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKM
QVYKDEQVVVIKDKYPKARYHWLVLPWTSISNLKAVTREHLELLKHMHTVGEKVIVDFAG
SSKLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEA
GRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ
Download sequence
Identical sequences A0A2I3RSU6
XP_001158076.1.37143 XP_001158297.1.37143 XP_003830162.1.60992 XP_008953728.1.60992 XP_008953729.1.60992 XP_008953730.1.60992 XP_009454714.1.37143 XP_016816198.1.37143 ENSPTRP00000035654 ENSPTRP00000035654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]