SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035724 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000035724
Domain Number - Region: 23-53
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0409
Family Gelsolin-like 0.032
Further Details:      
 
Domain Number - Region: 49-138
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0579
Family beta-CASP RNA-metabolising hydrolases 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035724   Gene: ENSPTRG00000020885   Transcript: ENSPTRT00000038642
Sequence length 223
Comment pep:known chromosome:CHIMP2.1.4:9:35048203:35051281:-1 gene:ENSPTRG00000020885 transcript:ENSPTRT00000038642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Download sequence
Identical sequences A0A096P1A7 A0A0D9RCQ4 A0A2K5KFS8 A0A2K5NAN0 A0A2K6D7G4 A0A2K6KES4 A0A2K6N972 F7HC83 G1QY61 G3QKA2 H2PRV9 H2QX68 Q99720
ENSPPYP00000021422 NP_001244806.1.72884 NP_005857.1.87134 NP_005857.1.92137 XP_002819712.1.23681 XP_003263436.1.23891 XP_004048016.1.27298 XP_007967104.1.81039 XP_010384096.1.97406 XP_011746368.1.29376 XP_011805897.1.43180 XP_011924626.1.92194 XP_017747539.1.44346 XP_520547.1.37143 ENSNLEP00000005882 ENSPPYP00000021422 ENSNLEP00000005882 ENSGGOP00000002873 ENSP00000277010 ENSMMUP00000027341 ENSPTRP00000035724 9544.ENSMMUP00000027341 9598.ENSPTRP00000035724 9600.ENSPPYP00000021422 9606.ENSP00000277010 ENSGGOP00000002873 ENSP00000277010 gi|5032117|ref|NP_005857.1| ENSPTRP00000035724 GO.91596 ENSMMUP00000027341 ENSPANP00000019132 ENSP00000277010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]