SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035842 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035842
Domain Number 1 Region: 154-262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-17
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 37-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 3 Region: 106-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000652
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035842   Gene: ENSPTRG00000020957   Transcript: ENSPTRT00000038770
Sequence length 278
Comment pep:known chromosome:CHIMP2.1.4:9:38912220:38927659:-1 gene:ENSPTRG00000020957 transcript:ENSPTRT00000038770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISAL
DECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGR
SYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRA
VPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGV
YQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM
Download sequence
Identical sequences H2QXA9 Q8WX77
ENSPTRP00000035842 ENSPTRP00000035842 9598.ENSPTRP00000035842 9606.ENSP00000366923 NYSGRC-IgSF-IBPL1_HUMAN ENSP00000366923 ENSP00000366923 NP_001007564.1.87134 NP_001007564.1.92137 XP_520431.2.37143 gi|56090548|ref|NP_001007564.1| ENSP00000366923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]