SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035898 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035898
Domain Number 1 Region: 34-337
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-97
Family Protein kinases, catalytic subunit 0.000000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035898   Gene: ENSPTRG00000021003   Transcript: ENSPTRT00000038838
Sequence length 351
Comment pep:known chromosome:CHIMP2.1.4:9:67564678:67565733:-1 gene:ENSPTRG00000021003 transcript:ENSPTRT00000038838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHRETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFSPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
Download sequence
Identical sequences H2QXB9
9598.ENSPTRP00000035898 ENSPTRP00000035898 XP_528314.3.37143 ENSPTRP00000035898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]