SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036043 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036043
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-60
Family Protein kinases, catalytic subunit 0.00000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036043   Gene: ENSPTRG00000021084   Transcript: ENSPTRT00000039002
Sequence length 322
Comment pep:known chromosome:CHIMP2.1.4:9:86827893:86835422:1 gene:ENSPTRG00000021084 transcript:ENSPTRT00000039002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGIAFCHA
NNIVHRDLKHANLLIRQIGLTQIDMGLAVFSPTKNNLHTHQVATRSVGCIMGELLNGSPL
FPGKNDIEQLCVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDL
LGQFLLYPPRQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFH
VDRPLEESLLNPELIRPFILEG
Download sequence
Identical sequences ENSPTRP00000036043 ENSPTRP00000036043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]