SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036060 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036060
Domain Number 1 Region: 284-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-71
Family Protein kinases, catalytic subunit 0.000000000212
Further Details:      
 
Domain Number 2 Region: 54-169
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-31
Family SH2 domain 0.000000406
Further Details:      
 
Domain Number 3 Region: 11-49
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000039
Family SH2 domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036060   Gene: ENSPTRG00000021098   Transcript: ENSPTRT00000039024
Sequence length 544
Comment pep:known chromosome:CHIMP2.1.4:9:89626775:89680794:1 gene:ENSPTRG00000021098 transcript:ENSPTRT00000039024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGQALEQAIISQK
PQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEG
KVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG
GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWA
AEKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQ
MKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMA
ELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKIS
DFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQK
PYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYY
DVVN
Download sequence
Identical sequences ENSPTRP00000036060 9598.ENSPTRP00000036060 ENSPTRP00000036060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]