SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036206 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036206
Domain Number 1 Region: 374-635
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-55
Family Nuclear receptor ligand-binding domain 0.000000018
Further Details:      
 
Domain Number 2 Region: 302-379
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036206   Gene: ENSPTRG00000021186   Transcript: ENSPTRT00000039178
Sequence length 637
Comment pep:known chromosome:CHIMP2.1.4:9:98630154:98668696:1 gene:ENSPTRG00000021186 transcript:ENSPTRT00000039178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDSIRFGNVDMPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITA
TATTSLPSISTFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQ
QQHQQPSIPPASSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAP
GPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAA
AAGSQAAALEGHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPNRSSSSGE
GTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRF
QKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDS
TPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLL
IESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNL
DIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVRGALVE
LRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences A0A2I3T457
9598.ENSPTRP00000036206 ENSPTRP00000036206 ENSPTRP00000036206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]