SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036284 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036284
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-20
Family First domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036284   Gene: ENSPTRG00000021239   Transcript: ENSPTRT00000039266
Sequence length 798
Comment pep:known chromosome:CHIMP2.1.4:9:108099692:108207002:-1 gene:ENSPTRG00000021239 transcript:ENSPTRT00000039266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHT
PELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGR
DGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFV
FRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSR
LRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRW
HPHSPNVSYPLPSPVLSSSDRLPFGIEENGGTPFLTAASGRHHHQHQHQHQHQHHSNYSL
SLTLENKEGPLRSPNSSSKSLTKLSPGTPALFSEAAAHLKKLELETVKAAGPWPPLHINI
NKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNLQGGKEESPFVNINKKSS
LQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTSTT
TNTTTAATQVSVPLPSPKVQNISSPHKSEGKGLLSPGAKSPSDRGGAFTLEPGDLLMDFT
EATPLAEPASNPHCAHSRCSPPLSLPMKEETTGVCMYPPIKTRLIKTFPVDTMNPFPDTF
TAGPQFTADFRDSKLQCCPGPTSPLIPAATLRPLTETISTVQTIYTTRKPVSLAASAETL
RQELEREKMMKRLLMTEL
Download sequence
Identical sequences ENSPTRP00000036284 ENSPTRP00000036284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]