SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036403 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000036403
Domain Number - Region: 398-464
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00065
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036403   Gene: ENSPTRG00000021301   Transcript: ENSPTRT00000039398
Sequence length 761
Comment pep:known chromosome:CHIMP2.1.4:9:118164260:118373600:-1 gene:ENSPTRG00000021301 transcript:ENSPTRT00000039398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVER
HRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDT
IIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMR
RLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQE
KFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEA
YKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATEAQRQKIQRTA
RKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT
LCQRPIPCVIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETD
LDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHM
VIGMSMRICQMRNSSLDPMFFVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNW
TLLLGNRWKTFFETVHIYLRSRTRLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGY
SLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLF
SCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
Download sequence
Identical sequences A0A096P0R4 A0A0D9RL29 A0A2K5N0F5 A0A2K5ZC28 F7HMK5 G1S4X0 G7PRK2 H2QXS6 O60477
NP_001247907.1.72884 NP_055433.2.87134 NP_055433.2.92137 XP_003264107.1.23891 XP_003833134.1.60992 XP_005580994.1.63531 XP_007966435.1.81039 XP_011844222.1.47321 XP_011946902.1.92194 XP_520219.2.37143 ENSP00000265922 ENSNLEP00000020558 ENSPTRP00000036403 9544.ENSMMUP00000008678 9598.ENSPTRP00000036403 9606.ENSP00000265922 ENSMMUP00000008678 ENSP00000265922 ENSNLEP00000020558 ENSPANP00000018939 ENSPTRP00000036403 ENSMMUP00000008678 ENSP00000265922 gi|148529000|ref|NP_055433.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]