SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036496 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036496
Domain Number 1 Region: 130-141,232-466
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-49
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036496   Gene: ENSPTRG00000021357   Transcript: ENSPTRT00000039501
Sequence length 480
Comment pep:known chromosome:CHIMP2.1.4:9:123550030:123625611:-1 gene:ENSPTRG00000021357 transcript:ENSPTRT00000039501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTC
LICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKC
LQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSP
GNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLP
PQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELLFRQIA
WIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR
FSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLLFKVVLHSCKTSVGKE
Download sequence
Identical sequences H2PTD1 H2QXV7
ENSPPYP00000021961 ENSPTRP00000036496 XP_009243128.1.23681 ENSPTRP00000036497 9598.ENSPTRP00000036497 ENSPPYP00000021961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]