SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036840 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036840
Domain Number 1 Region: 189-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-53
Family DBL homology domain (DH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 378-539
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-32
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 657-758,835-861
Classification Level Classification E-value
Superfamily SH2 domain 1.42e-25
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 5 Region: 784-863
Classification Level Classification E-value
Superfamily SH3-domain 1.03e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 565-651
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000122
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036840   Gene: ENSPTRG00000021525   Transcript: ENSPTRT00000039868
Sequence length 867
Comment pep:known chromosome:CHIMP2.1.4:9:133239515:133490984:-1 gene:ENSPTRG00000021525 transcript:ENSPTRT00000039868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLE
DLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASRE
DFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEA
MQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVHTKQDRY
LFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQ
FFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQG
YMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAVQNYHGNPAPPGKPVLTF
QTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAY
PWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHI
TEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFS
FLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVRIYSRIGG
DQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSPTRP00000036840 ENSPTRP00000036840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]