SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037178 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037178
Domain Number 1 Region: 4-76
Classification Level Classification E-value
Superfamily EF-hand 9.84e-20
Family Calbindin D9K 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037178   Gene: ENSPTRG00000021699   Transcript: ENSPTRT00000040240
Sequence length 79
Comment pep:known chromosome:CHIMP2.1.4:X:16776733:16781243:1 gene:ENSPTRG00000021699 transcript:ENSPTRT00000040240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ
Download sequence
Identical sequences A0A096MUK9 A0A2I2ZVR9 A0A2K5HZS9 A0A2K6CQ54 A0A2K6QJP6 H2PV04 H2QYC5 P29377
ENSPPYP00000022545 NP_004048.1.87134 NP_004048.1.92137 XP_002831466.1.23681 XP_003819571.1.60992 XP_010367548.1.97406 XP_011733521.1.29376 XP_011795639.1.43180 XP_016802861.1.37143 XP_016885330.1.92137 XP_018875522.1.27298 ENSP00000369547 ENSP00000369547 gi|4757898|ref|NP_004048.1| ENSPTRP00000037178 ENSPTRP00000037178 9598.ENSPTRP00000037178 9600.ENSPPYP00000022545 9606.ENSP00000369547 ENSP00000369547 ENSPPYP00000022545 ENSPANP00000003523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]