SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037506 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037506
Domain Number 1 Region: 166-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-63
Family Protein kinases, catalytic subunit 0.0000000354
Further Details:      
 
Domain Number 2 Region: 20-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.8e-19
Family Ras-binding domain, RBD 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037506   Gene: ENSPTRG00000021846   Transcript: ENSPTRT00000040588
Sequence length 382
Comment pep:novel chromosome:CHIMP2.1.4:X:48065871:48073415:1 gene:ENSPTRG00000021846 transcript:ENSPTRT00000040588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPRGPPANGAEPSRAVGTVKVYLPTKRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVV
YRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFPRTQHCDPEHFPFPAPANAP
LQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDKNLGYRDSGYYWEVPPSEVQLLKR
IGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTR
PGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNI
FLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAY
GVVLYELMTGSLPYSHIGCRDQ
Download sequence
Identical sequences ENSPTRP00000037506 ENSPTRP00000037506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]