SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037513 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037513
Domain Number 1 Region: 257-308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 137-186
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000602
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 189-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 77-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 5 Region: 311-371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 376-415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037513   Gene: ENSPTRG00000021849   Transcript: ENSPTRT00000040596
Sequence length 469
Comment pep:known chromosome:CHIMP2.1.4:X:48125057:48130841:-1 gene:ENSPTRG00000021849 transcript:ENSPTRT00000040596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNT
AFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSEKVAPGTL
EWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRKRACNHPAPKCGGHCPGQAQE
SEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPG
LAYEHRRCTGLPPCPVAGGWGPWSPVSPCPVTCGLGQTMEQRTCDQPVPQHGGPFCAGDA
TRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRC
AGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL
Download sequence
Identical sequences H2QYJ2
XP_521039.2.37143 9598.ENSPTRP00000037513 ENSPTRP00000037513 ENSPTRP00000037513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]