SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037557 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037557
Domain Number 1 Region: 31-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-69
Family Protein kinases, catalytic subunit 0.0000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037557   Gene: ENSPTRG00000021875   Transcript: ENSPTRT00000040645
Sequence length 311
Comment pep:known chromosome:CHIMP2.1.4:X:49248871:49254828:-1 gene:ENSPTRG00000021875 transcript:ENSPTRT00000040645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTKPLQGPPAPPVTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
Download sequence
Identical sequences H2QYK5
XP_003807283.1.60992 XP_528972.3.37143 ENSPTRP00000037557 ENSPTRP00000037557 9598.ENSPTRP00000037557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]