SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000037773 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000037773
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-71
Family BAR domain 0.0035
Further Details:      
 
Domain Number 2 Region: 389-564
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000207
Further Details:      
 
Domain Number 3 Region: 263-364
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000037773   Gene: ENSPTRG00000021979   Transcript: ENSPTRT00000040885
Sequence length 802
Comment pep:known chromosome:CHIMP2.1.4:X:67787743:68175128:-1 gene:ENSPTRG00000021979 transcript:ENSPTRT00000040885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPPLEFSDCYLDSPDFRERLKCYEQELERTNKFIKDVIKDGNALISAMRNYSSAVQKF
SQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMMVHNASDLLIKPLENFR
KEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLD
YVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNTRNHFS
STREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKTLTM
TPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWM
EAMDGKEPIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLYRTVGSNIQVQKL
LNAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDY
RLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTV
AAMMNIKFQNIVVEILIEHFGKIYLGPPEESAAPPVPPPRVTARRHKPITISKRLLRERT
VFYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSPSRPISDG
KLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEG
DADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPKPDIVAGNAGEITSSVVASRT
RFFETASRKTGSSQGRLPGDES
Download sequence
Identical sequences H2PVW4 K7B6H0 Q7YQL5 Q7YQL6
9598.ENSPTRP00000037773 9600.ENSPPYP00000022866 ENSPPYP00000022866 NP_001009021.1.37143 XP_009437484.1.37143 XP_009437485.1.37143 ENSPTRP00000037773 ENSPTRP00000037773 ENSPPYP00000022866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]