SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038219 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038219
Domain Number 1 Region: 121-594
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-148
Family Calponin-homology domain, CH-domain 0.00000000505
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.52e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038219   Gene: ENSPTRG00000022205   Transcript: ENSPTRT00000041377
Sequence length 603
Comment pep:known chromosome:CHIMP2.1.4:X:116215458:116256070:1 gene:ENSPTRG00000022205 transcript:ENSPTRT00000041377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVG
IGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNKARYAVSMARIGARVY
ALP
Download sequence
Identical sequences ENSPTRP00000038219 ENSPTRP00000038219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]