SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038373 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038373
Domain Number 1 Region: 24-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-82
Family Protein kinases, catalytic subunit 0.0000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038373   Gene: ENSPTRG00000022277   Transcript: ENSPTRT00000041549
Sequence length 438
Comment pep:known chromosome:CHIMP2.1.4:X:132630976:132683612:1 gene:ENSPTRG00000022277 transcript:ENSPTRT00000041549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA
EDEIEDIQQEITVLSQCDSSYVTKYYGSYLKDHGISRHLKFQQMEMLLHSRKLGSKLWII
MEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDV
KLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPP
NSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNS
KKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKV
QNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDK
MVKKLIEKFQKCSADESP
Download sequence
Identical sequences G3RBZ7 H2QZ44
ENSPTRP00000038373 ENSGGOP00000013013 ENSGGOP00000013013 ENSPTRP00000038373 XP_003317731.1.37143 XP_003814533.1.60992 XP_004064918.1.27298 XP_016799562.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]